TitleProduct

Exenatide Acetate CAS NO.141732-76-5 , 141758-74-9

  • Price:

    Negotiable

  • minimum:

  • Total supply:

  • Delivery term:

    The date of payment from buyers deliver within days

  • seat:

    Zhejiang

  • Validity to:

    Long-term effective

  • Last update:

    2019-09-17 23:18

  • Browse the number:

    257

Send an inquiries

Company Profile

Hangzhou Go Top Peptide Biotech Co.,Ltd.

By certification [File Integrity]

Contact:gutuo(Mr.)  

Email:

Telephone:

Phone:

Area:Zhejiang

Address:Zhejiang

Website:http://www.gtpeptide.com/ http://gutuo.amfp-inc.com/

Product Details


Product Name

Exenatide Acetate

Synonyms

Exendin-4;Exenatide;Exenatide-d5;PC-DAC

CAS No.

141732-76-5, 141758-74-9 (net)

Catalog No.

GT-B004

Sequence(3-letter code)

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-
Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-
Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-
Ala-Pro-Pro-Pro-Ser-NH2

Sequence(1-letter code)

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Molecular Structure

Molecular Formula

C184H282N50O60S

Molecular Weight

4186.66

Key Specification

Appearance: White powder
Purity (HPLC) ≥98.0%
Acetate Content(HPLC): 5.0%~12.0%
Water Content (Karl Fischer) ≤10.0%
Bacterial endotoxin ≤5EU/mg

Package

1g, 5g, 10g, 20g, 50g, 100g.

Description

Exenatide is a glucagon-like peptide-1 (GLP-1) analog. It functions to activate the GLP-1 receptor and increases insulin secretion, decrease glucagon secretion, and slow gastric emptying to improve glycemic control

Storage

Keep cool & dry place(Store at -20°C, away from the light)

Remark

For Research Use Only. Not for human use.


http://www.gtpeptide.com/